GenomeNet

>tr:A0A1I4NHD6_9BURK [A0A1I4NHD6] RecName: Full=Cell division protein FtsL {ECO:0000256|HAMAP-Rule:MF_00910};
MLTRLNLLLLFAVIGSALYLVHIEYTARQLYTQMHKAEQETRRIELDFDRLQLEKRAQAT
PLRVEKLAREQLKMRTATPAITQYVRPDGTVIPAVAPLPPTTPPTGKPAPAGAAARSQR

BLAST