GenomeNet

>tr:A0A1I4TSE8_9EURY [A0A1I4TSE8] RecName: Full=Probable thymidylate kinase {ECO:0000256|HAMAP-Rule:MF_00165}; EC=2.7.4.9 {ECO:0000256|HAMAP-Rule:MF_00165}; AltName: Full=dTMP kinase {ECO:0000256|HAMAP-Rule:MF_00165};
MKGKLITLEGIDGSGKSTITARLNSNPEFSDFVFTREPTTGWIGEAVNRAIHSDTDELAE
LLLFTADHAEHISKLILPALESGKNVISDRYSGSRFAYQAVTLKDRFPDPMQWIQDIHKG
WTVVPDLTILFDIDPKIAVERCGNRGDKTKFEKIGFLEEVRENYLRLARQDPERFAVIYT
DKNIDDIEADVLDMITSFLR

BLAST