GenomeNet

>tr:A0A1I6YTG1_9ACTN [A0A1I6YTG1] SubName: Full=TRSP domain C terminus to PRTase_2 {ECO:0000313|EMBL:SFT53724.1};
MTATLRAAGPGGDVLRAAGPGGDVLRAAGPGGDVLRAADLGGTVSGLLDVDVASRGRFAQ
LCGLGLRDNPRRAHLVVSRVLGKHVPVVPDAVLGAGAAVGDAVAAVLGNEVPGLVIGYCE
TATGLGHAAADRLGAAYLHTTRRLHPGVPVAAAFEEEHSHAVAHALQPVGPVALDVPGAL
VLVDDELTSGRTALNTIAELDLCWPRERYVVATLLDARTPAARAAFAGRAEALGVRVDVA
AVLATELTLPADVLGRAAAARAALPAAAPPPSGAPGSVVVHEGLWPAGVPTGARHGLTPA
GSARLADAADAVAAALVPVLAGSRGVLVLGTEELMHAPTVIGARLSGRLPGVPVTTQSTT
RSPVHAADDPGYALRRSLAFPAPDDPARVSRVHNLADPAAVPAAGPWSDQRADDVVVVVD
APAADCAAMGEALRPFAARAVHLVTVPIAEPGA

BLAST