GenomeNet

>tr:A0A1I7U7P5_9PELO [A0A1I7U7P5] SubName: Full=Uncharacterized protein {ECO:0000313|WBParaSite:Csp11.Scaffold629.g15688.t1};
MEEQKQLLDCFYNGIMTVFGGKSVPDKLINLLKIMIHMDEEDVTVSLRLFNSLDVSLAQY
VDVFDLIRDLRNDFEEAERVIQKIEGMMREVEIMEDSESDDSGFNSDNEEEEPS

BLAST