GenomeNet

>tr:A0A1I8CSJ0_9BILA [A0A1I8CSJ0] SubName: Full=Uncharacterized protein {ECO:0000313|WBParaSite:RSKR_0000743200.1};
MDDNNLLQNRERFTSSSNVSLDAFHNTNLHIGDVISLYAVDNSPKKNEVEKQVKYEGFLS
TLGLVDDRCLVELNNGSLASPPKNYRDCLFRVCPVYRYAAQKQYWSEQKKCLAGEPFDEE
MLNKLRIAAEKEKEQNEMEFRKMLGTQIQYGTSIQLLHVKSDKFLTMQKNSQAKVERNAM
RVYLDKAGNEGCWFVVEPVYKHVSIGYGVMSSERIYLVPYANGSQTNVGHSKHQLHLSHM
KLPDHDNACEVNILNENTEWQVNLFLQFDENLSDFVKSGDVVRLFHADQQTFLTLDKIPL
TKEEVAFLRLTNRSSAADATSSKALWEVQIFNKDFAYRGGTATWRKFIRFKHLATDLYLK
VVALRNEVSEIKDKIKIVEPNGDITFSQPEDIIDDIKRDTIDLMKGDRFLNTKKSYGNDT
IVYMLSPDDPSDPAKDESLLFLLDPCKITSGKDQKVPINSFVRLQHQQTGTWVHTTNPIN
KNNVFYANKSEKGWVKVICENTKIDKEAFALSPVSPKEVRDLDFANDACKALMQFIDVIL
SGKTLRNDMINTSNQLLVECIYFVTGVSDHMIDPLNIVEFSPSRDRQKLLREQGVLKQVF
ALLRAPFQPRHIKDKITNAKIDQEPLLTADSLGRSSNLVFKKMFRYCYALLKYAQSGYRK
NQEFLAEKFEQIQEQIGFDLMAEDTMTAVLHNNPKLLEKYVKAPHVIRFVELVRFNNAGK
FLDYLADLCVCRGEANKKIQELICTIVLKEEYSDIIMDTEKRPILNPTPEDIYNFRKFDV
YLCWKENYCKQLVDCATNANNDNEDGRMLDYYRHQLGLLAQMCQDQQYLAIDPPPERKLL
NISQELPLELILQCMADEKLPSDIRACFTRLMLHLHVVRGSPISAVRHARLWRDIPDSIS
VKEYSTSAVEGYVDGSRTKHADDEVAFTNVLKIVERYLANVLKAAKNNEPVLNESGAFCD
QNKLTYEVVNLARALAQFGFYSFADLLQLAQNLLSIADSAPNQQDCQSVLKEGMKMVSKM
TKGMVSQDFTANTLAQNAMSFNLDNVDTQAEDAIKAKTSRELVLQTKLIIVEILQFAIDV
KRDYSITVALSWFKNKFPCNDEGELTIHHLGNQEVSSDLCKVVFDAIDTEIDFDGQKGQQ
LLRILMQMTMNDFPMLTSMALKVLFRHFTQYQELIEDLKQVQMLVSNNDVDNYHQIDRDV
FILKNLTEKSELWVNWGVGENDHKISVTEISGNPGKVQISRQTTMERSNSNDDMLSHDPL
DEELEKGLDEKMIADLHTIPQNLREFIHDHYASTKIDCMRDLLTLLKSSDKKETSNSLHK
LMDKAPLLGYPLIKDILQRFETLCYKDNKADGMNQQLLRNMKVYEVVLEFISIPFDKKND
SEMPKLISISHVFLRAFCKNNKENQNRLHKFVSIESGRNDGQLSIETFEEVETLTAIFMN
NHDLSENVAESLIAHVVGLIEHKGKNCLFLKFLQSIVSVQDKQIESTQLKVIEELIKSTE
EVKSFYTNAAEFYTLKELMKKDYNVCNDLPDNNALNYHIELVRLMALCTKGKNGNTELKC
ASFLPMDQIVKVITSEVCSVKVKSVYLQFMMHCYIDTDIELKDACNSDYIEYILKNILSD
LTNFHIGKAPSPASLHPPNVMHITNYNNVSPANPFVDQLESYICTTVTEVLSKFFERQFN
SRAVIDVKQHRATFSLIVQRLNDITNGRIALQKNQSKSWYRVTECLKRLKTVATEHNIVL
PAAIQMPETNQVVNAKARWQSVANKTRFIAKNTANLTLKSARNYTGTNVTVRHPGVHGET
SNVVVCYQSIINDFKNYLHPLHAAESSVLVDVLHFPEKLFPVGSPLREQCANGKAVTKLI
QHCKLLLQNKQENLCVRVIQTLCKMATCTKYNFTSEGKKLRLLLIKRYFGNNVVEPPPEA
LSIHKMKTVASKEINEKAPPEAYIFNSDLKPIIDISHYETQCKLNNAGAVDLVIELAIAD
ISQEIFLKACQLAKALLYEGNKDVQLSFYQRLRDKSVASKFFKTLVNKFQTAQNRLKSDM
MSGNSLRQRTASAVMTPLPNDNNDVNSNGFLAQIRNSTHNLISGATPSTPPEVHHRHSIG
ADTDISSHLGLGANYDIANFHEEEKPKDLLSQEVSIMEPILRFLQLLCENHNGMLQDFLR
TQGSRPDYNLVAETLTFLDTICGSTKGSLGVFAEIGEHNFSLITQTLITLTEFCQGPCHE
NQNTMALHESNGLDIIISLVLNDIKPLADEHMELALEIKSNASKLLLAVMESRHDSENAD
RVLGNMSHTSVGVGQLIKAISQAYNMTDSDSYTVSKFKETFMAHNSNYGTPMPNTTSAMF
SDSFKAAKDELKYGKEVDKSQSYANAIYNTYESSNLDPKEVGHNIYILAHQLARHSTELT
NELDPDNHENPKTKAALQFYKEHTAQIEIVRADRKMERVVFPIHDICLYLTPETKQTVYV
RTERDNQGSKVTDFFEQWEELYNEMKWQRKLEDQPILSLITQLLPIWGRLAFFLAILVNV
IIALYYPFGSTSEDAINHKNPFILIVLALSDVVASDETLRNVIRSVTRNWKSICLTGMLA
LILVYQFSIVGYMFFQKDFQIDVDPLDSEEIVSKIDVDPFLISKLPSDVESCTKSSDSES
DGKVPGCDTLRMCILTTLNRGLRNGGGIGDVLRNPGPNEAFFFHRIIYDMTFFIVLIIIV
LNLIFGVIIDTFGDLRSEKNEREDILKNTCFICGLERGKFDNHSVSFDEHRESEHNLWHY
LYFIVWLQVKDSTEFTGPESYVSYMINQKQVDWFPRMQAISLIEDGTESDQPQFKDFQDQ
LKALEGVIRDLNSRTISMQRVMSDISMD

BLAST