GenomeNet

>tr:A0A1I8N5Q4_MUSDO [A0A1I8N5Q4] SubName: Full=Uncharacterized protein {ECO:0000313|VectorBase:MDOA011823-PB};
MGDNIIGSASFLHLGDIVSLFAEGSVCGFLSTLGLVDDRTVVCPEAGDLNYPPKKFRDCL
IKVCPMNRYSAQKQFWKAAKQSASSNTDTNLLKRLHXXAEIEKKQNETENKKLLGTAIQY
GSVVQLLHLKSNKYLTVNKRLPSLLEKNAMRVYLDANGNEGSWFYIMPFYKLRSIGDNVV
VGDKVILNPVNADQQNLHVAANYELPDNPGCKEVNVLNSSTSWKITLFMEHKENQDHILK
GGDVVRLFHAEQEKFLTMDEYKKQQHVFLRTTGRTSATAATSSKALWEIEVVQHDSCRGG
AGHWNSLYRFKHLATGYYLAAELDSENGGSLGSGISASSVGQLQQQQQIHQTPTQLLNIS
AENAKDSGISCNSTMIDKGKLEHYRLVSVPFSTDIATVFELDPTTMARADSLVPQSSYVR
LRHLCSNTWVHATSIPIDIDDDKPVMSKVCCSPVKEDKEAFALIPVSPVEVRDLDFANDA
CKVLVVVTAKLDNGTISINERKSLISLLQDIVYFIAGMENEQNKTKALELTIKNPIRDRQ
KLLREQYILKQLFKILQGPFQEHPGGDGPFLRLDELSDPKNSPYKNIFRLCYRILRLSQQ
DYRKNQEYIAKHFGLMQKQIGYDILAEDTITALLHNNRKLLEKHITAAEIETFVGLVRKN
MHNWDSRFLDYLSDLCVSNRKAIAVTQELICKSVLSTKNSDILIDTEVKIVKAPKFGFPK
QSDINKPLSPLTEVVDDDDKLDLISTKTSSTWDLRSLDGDAEGDNVKYEIHLKWKGLKES
RSMADLANCVAQGKEQEIAILNYYRHQLNLFSNMCLNRQYLALNNLSPHLDIDLILKCMS
DETMPYELRASFCRLMLHLHVDRDPQEPVTPVKYARLWSEIPSKMSILDYDGKNQQPDYN
KEAVRAKFNTTIAFVENYLCNVAAKVWLFTDQEQNKLTFEVVKLARDLIYFGFYSFSDLL
RLTKTLLCILDCVSDSSIDSSTAAGPNAGRFEAAVTDSEGGVLRSIGDMNTVMTSLALGS
VGQVMATPAISSLQQRKSVSQLMKEFPLVMDTKLKIIEILQFILDVRLDYRISCLLSIFK
REFDESDAHQYANQSEAATATVTSAPYVQTSTTTITTTSDSGISSSSASTAAGVSGGGGG
GGDNTSTSNTTSSTSTSNTNTTSGTQDAQSSAAAAAAFQQRQKNIDLESIGIQAEGIFDC
DSGDAANLDLDGQGGRTFLRVLLHLIMHDYPPLVSGALHLLFRHFSQRQEVLHAFRQVQL
LVSDNDVESYKQIKHDLDILRQSVEKSELWVYKSKTSEELSTTVGESSIDNSNLTNEYRA
SLSTEQLAEYKKVKEILIRMNQFCVTQGPYVKPRKHEQRLLRNVGVHTVVLDLLQNPYDE
KDDVLMKELMFLAHEFLQNFCLGNQQNQVLLHNHLDLFLNPGILEAKTVCAIFKDNLTLC
NEVTDKVVQHFVHCIEIHGRHVVYLQFLQTIVKAENQFIRKCQDMVMQELINAGEEVLVF
YNDKSSFNQLVHMMQTQKTPLSDDSPLKYHVELVKLLACCTMGKNLYTEIKCNNLLSLDD
IVAVICHPACIPEVKEAYVDFLNHCYIDTEVEMKEIYSSGHMWNLFEKSFMVDINLLINT
GINADKTLINYVLNGICTILASFFSSPFSDQSTIVQSRQMIFVQLLQVCYRLSQCKWLSL
ADRFNVENCIRTLAESAKTRSIAIPLDLEQQVVTMSSKTALLTRQTTKWLLASKQPKYET
QHSANLMRLDRSIIEGLQDIVSLLEDQLKPVVEAELSLLVDILYRSELLFPQGTEARKRC
ESGGFIRKLIKHTEKLLEEKEEKLCVKVLKTLREMMAIDVNYGEKGDALRSTLLKRYFDI
KPSNTSRTPVEPKTDILSLTQDPQKQHLNLVTHGPGAKYLQRAEKTLHEVQNHLDREGAS
DLVIELVIKSVHSPSIFVEAIELGIALLEGGNPIIQKGMYTKFLSGDLNQAFFKVFFDKM
KDSQQEIKSTVTVNTSDIAAKAHESKQDVNLELDKISRKHGVKTNGVVITDELRKELHNA
GLATARAFSNARNLHAGEDSNSLNLNSPFDDILAEKLEKHKDNKEDRNKLSNKVLVMQPI
LRFMQLLCENHNPDLQNLLRNQNNKTNYNLVSETLMFLDCICGSTTGGLGLLGLYINENN
VALINQTLETLTEYCQGPCHENQNCIATHESNGLDIITALILNNINPLGENRMDLVLELK
NNASKLLLAIMESRGDGENAERILYNMNPKQLVDVACKAYHQEEMIDDHDGDEDGVAAEH
DDDDDVSVSPREVGHNIYILCHQLAQHNKELASLLKVSEDPQSPNYDAKMSQALMYYATH
TAQIEIVRHDRTLEQIVFPIPEICEYLTTDTKMKIFQTAERDDQGSKVADFFDKAEEMFN
EMKWQKKLRGQPFLFWVSSYMSLWSNILFNCVVVINIIVAFFYPFDNTVPELSSHISLLF
WAIMIFSLVIVVTLPRESGIRTLIGSIILRSIFLLGPESTLCLLGVVTVTLKSVHIISIM
GNKGTLEKHFLKIITDFQLLYHCIYIFFCFCGLIFHPFFYSLLLFDVVYREETLVNVIRS
VTRNGRSIVLTAVLALILVYLFSIIGYMFFRDDFLLEVDVDHVENAVEAATLSVNPDSTC
STPDSLENPKLITTGDGEVKERSCDSLVMCIVTTLNQGLRNGGGIGDILRAPSSKEGLFA
ARVIYDLLFFFIVIIIVLNLIFGVIIDTFADLRSEKQQKELILKNTCFICGLNRSAFDNK
TVSFEEHIKSEHNMWHYLYFIVLVKVKDPTEFTGPESYVYAMVKAGILDWFPRLRAMSLA
AVDADGEQIELRSMQAQLLETQMLITNLSQQLHELKDHMTEQRKQKQRLGLLNTTASSFM
TGYQFQ

BLAST