GenomeNet

>tr:A0A1J5GQY3_9BACT [A0A1J5GQY3] RecName: Full=Chromosomal replication initiator protein DnaA {ECO:0000256|HAMAP-Rule:MF_00377, ECO:0000256|RuleBase:RU000577};
MTKDELWQLVLGELELSLSKASFDTWFKNTFIAALENEQVIIGVPNLFTQAWFEKKYHEL
IIKTLKKITSNQVKNIIYKIETRKNVLTLAENQITQQITGNLEPAVSDEKLTTTNNSSGL
NPKYTFDKFVVGKNNELAHAAAMAVADKPGVVYNPLFIYGGVGLGKTHLLQAVGHMVIQK
TKDVKILYTTTEKFTNDFVQAIRSGKTKSFQDKYRDVDLLIMDDVQFMEGKGQTQEQFFH
TFNDLYQKNKQIIISSDRPPKAIPTIEDRLRSRFECGMIADISAPDLETRIAIIGAKLIE
KAYQLEDEIINLIATSIQSNIREIEGAINRIIAYHELKKEKPTMETVKPILSSLINLPRK
GSITPKIITEIVAEYFDIAINDILGSCRKKELVVPRQIIMFLMREELNYSFPNIGSELGG
RDHTTAMHAHNKIKNKMLDDEKLKQDVILLKQKIFNLA

BLAST