GenomeNet

>sp:A0A1L8FQP4_XENLA [A0A1L8FQP4] SubName: Full=Uncharacterized protein {ECO:0000313|EMBL:OCT73912.1};
MADGPRCKRRKQANPKRNDVTNYNSVLEANSDSDDEDKLHIVEEESVTDAADGEGSVPED
DLPTDQTVLPEGSESGKGSTKTCWEDEEGADCCDEILGPEAEADELGVKDEECDSDLENE
QNHDPNVEEFLQQSDTAVIYPEAPDDEQRQGTPEAVGQDENGTPDAFSQLLTCPYCERGY
KRFTSLKEHIKYRHEKNEDNFSCSMCSYTFAYRTQLDRHMTSHKSGKDQRHVTQSGGNRK
FKCPECGKAFKYKHHLKEHLRIHSGEKPYECSNCKKRFSHSGSYSSHISSKKCISVAPVN
GRVRSGLKTPQCSSPSLSASPGSPARPQIRQKIENKPLQEQLPVNQIKTEPVDYEIKPIV
VASGINCSAPLQNGVFTSGSLLQATNSPQGVVQAVVLPTMGLVSPISINLSDIQNVLKMA
VDGNIIRQVLENNHASLASKEQGTLTSATIQQAGHSVISAISLPLVDQDGTTKIIINYSL
EQPTQLPVVAQNLKKEVTAPAEVCKTEKLPEDLTIKTEKDTKFTDKSTCLLGADHPGDTN
ALQEPKHYDPKKNSLLPESSKAEVIKSEPSSANSEDGNLTPSQPPLKNLLSLLKAYYALN
AQPSAEELSKIADSVNLPLDVVKKWFEKMQSGEIPVDSSQPSSPKPSQNSVTENSVKSKT
ESGLNDGTSVPLKSPKQEAEEPLAVNGSESGTASPTPLNLSSLENSDGAACTDGTPDGEQ
QAEPLDLSLPKPQGNVPERPSITSVYQSSSYSVQEEPLNLSCVKKEPMQVDNAAKAETTL
IINPSANPINIAIPTVTAQLPTIVAIADQNGVPCLRALAANKQTILIPQVTYTYSTTASP
AVPEPQVKNIQPNGNQDERQDTSSEGVSNVEDQNDSDSTPPKKKLKKTENGLYACDLCDK
IFQKSSSLLRHKYEHTGKRPHECGICAKAFKHKHHLIEHMRLHSGEKPYQCDKCGKRFSH
SGSYSQHMNHRYSYCKKEAEERDGMEQEESAQENLSNEHVDSQVSPSQIDSDEQESITRE
EDSEKEEEDEKDADDGQEEKERVGDGDVEEGEAEPLAGTLKDEECAAEDKCLEEEVTEEN
VSDEDLTQP

BLAST