GenomeNet

>tr:A0A1L8Z8W2_BORBI [A0A1L8Z8W2] SubName: Full=Uncharacterized protein {ECO:0000313|EMBL:OJH14176.1};
MADDQDKLLIDEEETVQIKDLNKVTTVNNTDLLLLDDGAASSNAITFKNFLKTVNHQTFK
GEELGYFKEIIKSTIATELAADKDFVKSIYDLIVDKLIENESSKLSNLFSKIKSRLTDSI
SSATLSRSDDLLIMSSSTIQKTPVPKQLLGVPSDFSHGRSFEFGPTLYSSDYKNKSITIK
LENANDATLIFYKYNDNDPIYLDIELDVEHYSNTSIKALYLKYSDESQRNMVYEQSDAPR
ALSSRFPIYKGWYIQKRASSSGGSIPVLLKL

BLAST