GenomeNet

>tr:A0A1L8Z9L7_BORBI [A0A1L8Z9L7] SubName: Full=Uncharacterized protein {ECO:0000313|EMBL:OJH14444.1}; Flags: Fragment;
DLLIMSSSTIQKTPVPKQLLGVPSDFSHGRSFEFGPTLYSSDYKNKSITIKLENANDATL
IFYKKNDNDPIYLDIELDVEHYSNTSIKALYLKYSDESQRNMVYEQSDAPRALSSRFPIY
KGWYIQKRASSSGGSIPALLKL

BLAST