GenomeNet

>tr:A0A1L9UMX1_ASPBC [A0A1L9UMX1] SubName: Full=Uncharacterized protein {ECO:0000313|EMBL:OJJ73074.1};
MKLQFILSCWAILVARIWAITDGLTDLVAWDPYSLTVNGNRLFVYSGEFHYPRLPVPEMW
LDVFQKMRAHGFNTVSLYFFWDYHSPINGTYDFETGAHNIQRLFDYAQEAGIYIIARAGP
YCNAEFNGGGLALYLSDGSGGDLRTSDATYHQAWTPWIERIGKVIADNSITNGGPVILNQ
IENELQETTHSASNTLVEYMEQIEEAFRAAGVDVPFTSNEKGQRSRSWSTDYEDVGGAVN
VYGLDSYPGGLSCTNPSSGFSVVRNYYQWFQNTSFTQPEYLPEFEGGWFSAWGAGSFYDQ
CTSELSPQFADVYYKNNIGQRITLQNLYMLYGGTNWGHLAAPVVYTSYDYSAPLRETRQI
RDKLSQTKLVGLYTRVSSGLLGVEMEGNGTSYTSTTSAYTWVLRNPNTTAGFYVVQQDTT
SSQTDITFSLNVNTSAGALTLPNINLQGRQSKIISTDYPLGHSTLLYVSTDIATYGTFGD
TDVVVLYARSGQEVSFAFKNTTKLTFEEYGDSVNLTSSSGNHTITSYTYTQGSGSSVVKF
SNGAIFYLLETETAFRFWAPPTTTDPYVTAEQQIFVLGPYLVRNASISGSVVDLVGDNDN
ATTVEVFAGSSAKTVKWNGKEITVKKTDYGSLVGSIGGADSSSITLPSLTGWKVRDSLPE
TQSSYDDSKWTVCNKTTTLSPVDPLSLPVLFASDYGYYTGIKIYRGRFDGANVTGANLTA
QGGLAFGWNVWLNGDLVASLPGDADETSSNAVINFSNHTLKQTDNLLTVVVDYTGHDETS
TGDGVENPRGLLGATLNGGSFKSWKIQGNAGGAAGAYELDPVRAPMNEGGLLAERQGWHL
PGYKAKSSDGWTDGSPLDGLNMSGVAFYLTTFTLDLPKNYDVPLGIQFTSPSTVDPVRIQ
LFINGYQYGKYVPYLGPQTTFPIPPGIINNRDKNTIGLSLWAQTDAGAKLENIELISYGA
YESGFDAGDGTGFDLNGAKLGYQPEWTEARAQYT

BLAST