GenomeNet

>tr:A0A1M4TWB3_9CLOT [A0A1M4TWB3] RecName: Full=Ferrous iron transport protein B {ECO:0000256|RuleBase:RU362098};
MQGRFKLLNKTDYNTNLNAGQNDYIINKKPDDYIIGLVGNPNTGKSTLFNLLTGLNQHTG
NWPGKTVTSARGEFKLDDKNFILVDLPGCYSLFPCSLEEEVSRDFILKGNSDLIIVIVDG
TCLERNLNLVLQIKDVKKEIILCVNLIDEAEKKNIKINKELLEKELGIPVVLTSARHNTG
ISDLKNKILDIVNKKVNYDNFINNKNFYLDEKENNNMKENLTKKYFKKAEEIKSISVIEG
SSTLKKDMKIDNILTSKKFGIPIMILLLALIFWITIEGANYPSQMLSEFFIFLEDKLLIL
FNNLNAPTWLSGVLISGLFKTLGWVIAVMLPPMAIFFPLFTLLEDLGYLPRIAFNLDHLF
KKSCAHGKQCLTMCMGFGCNAAGVVGCRIIESPRERIVAILTNNFVPCNGRFPTIIALSS
IFVIALGYENVPSFFPPLAVTLIVVLGVIITLGTSYLLSKTLLKGVPSTFTLELPPYRKP
KVLRILYTSLIDRTLFVLWRAVKIAAPAGIIIWILANIYIGDLNIIGHISSFLNPFAVLI
GLDGVILLAFILGLPANEIVLPIILMSYLASGTLLEFDSINSLSQILLSQGWTALTALNT
MLFSLLHWPCSTTLLTIKEETGSLKWTILSFLIPTVIGIVVCFLTTFIYNIFI

BLAST