GenomeNet

>tr:A0A1M5BAB1_9BACT [A0A1M5BAB1] SubName: Full=Polysaccharide export outer membrane protein {ECO:0000313|EMBL:SHF39443.1};
MTITKIHLPLLLILPIFLSCVNTKKATYFNGLSDAEIQYKVQSLEPVIQKNDLLSIVVSS
INAEANQQFNLYTISSAQGPVNSGTVSQVSGFLVDQDGNIQFPMLGTLKASGLTKKQLKE
VITKGLIEKNLLYDPVVNIRYLNYKVTVLGEVAHPTVINVPGEKITVLEALGIAGDLTLY
AQRDNVLIIHEEEGGGKRIAKRINLNDEELLTSPYYYLKSNDIVYVAPNKSRVASTSTSK
QWLPAMLSGLSFFAIVIDRLTR

BLAST