GenomeNet

>tr:A0A1M6ANW6_9FLAO [A0A1M6ANW6] SubName: Full=Protein involved in gliding motility EpsA {ECO:0000313|EMBL:SHI38028.1};
MKYYNIILFVFLIFSATSCISTKKLTYLQENQEEIDSLIAVQRVQQTYRLQVNDLLSIRV
KALDQELVGIFNPIDNNNPNATGEEKLYYDGFRVDPHGNIRIPTLGEMNVLGFTVEEVRK
KIEAKLLEEYFREEANIFVTVKLAGIRYTTIGEVGSGSQVIYKDEVSIMEAIANAGDITT
LGDRTDVMILRQYPGGHKVHHIDLTNIDAVKSPYYYIQPNDLIMVKPLPQKSWGVGETGL
ETFTTIASIVSLFGTLIILSQRL

BLAST