GenomeNet

>tr:A0A1M6VFD6_9FIRM [A0A1M6VFD6] SubName: Full=LuxR family transcriptional regulator, maltose regulon positive regulatory protein {ECO:0000313|EMBL:SHK80243.1};
MAHTYVKIPEIYKKMKAAEAEKRVLFISAPVGSGKSAAIEYYLRRQDHLFLTGIDGRLNE
MPEGNEINQPFIVIDDVSWIVDPDSENYILDLIDICDRKGKTMILAGRSRLPSWLQPACI
EYGFILADERDLLFGEKQIKKIFQIHGIDLNESDVFEIMNETKGYPVSVTMLTYHMQDGK
DYSVDIYKAAQLDMYRYFFRTFYAQWDNELKEVLLAVSVFPSFTVQLAEMVTGNVNIRRV
IERAFSVGSFLFCGADDSYVMRPLLRGFLEWRCGIEYSKEWMNEIYGRAALYYEIRNDIE
NALYYYELADDRERIFQFLIKNAEKHTGTGHFFETRRYYLSLPKEMIVKSPLLMCGMSML
HSLLMQTEESEYWYDQLVQYEKRQEVGKRSRKEATMRRAYLDIALPHRGITNIIKTLKNT
AIMVTNKEIQMPEFSVTSNLPSIMNGGLDFCEWSKNDRNLAILMKKPVELLLGKHSPGLV
NIALAESFFEKSFEGQNDPDDYKIMTLLNSGYTMADMKGKIEMCFVAIGVMVKLHISHNQ
PQVAKTLLMEFREKAIAENALRLLPNIDAMRVWLKLLAGNMDIDKELSVENWLADDAPNE
NREFYILERYRYMVKIRVYIVMGQYEDAARLIERVLVYFEKYNRTFFWIQAHLLKAILQY
RLGKNEWQVNLQKAVSKAQEYKFTQIIAAEGAAVKPLLLQAQSLEWDDAYCAKVLNEVDR
EAQFYPDYLKERCLVEEPLTKMENTILHLLCKGNKSTDICDLYHISYNTLKYHNKNIYRK
LGVKNRAEAVQMAGELGIYRA

BLAST