GenomeNet

>tr:A0A1M7CGB3_9RHOB [A0A1M7CGB3] SubName: Full=Polysaccharide export outer membrane protein {ECO:0000313|EMBL:SHL66217.1};
MIRFLTAILFLIGSASVSMAQDFYRIKPGDTLQVEVLEDPGLNRSVLVLPDGSISFPLAG
TVKVGGRSVDTVASTLSKEMASNFAVSPTVLVSVAALAPKSSSRAAAQPNLMNVYILGEV
NNPGRKEILPDTTLIQFLAEAGGLSRFAAEKRIQLRRVDPAGGDETVYRFNYRTMGGSDS
ISGTTVLAPGDVIVVPERRLFE

BLAST