GenomeNet

>tr:A0A1N6KP96_9BURK [A0A1N6KP96] RecName: Full=LPD22 domain-containing protein {ECO:0000259|Pfam:PF18834};
MAGFDLDSAQPIGGAPTAAPAPSDNVFDLATAKPIGQAQTLQAAQGVAVANSEQSADAAG
RAAGIAKQIGAPQAAVETDLPRYEAQAKAQNNAQILSQSPRLADWVANNPDSARVAQDDF
DGMSQLEGLTSAQSAQALTATKDMLTGLAKGVGSSFTSSALALNRAVGGGLSLLDKATGT
DAGDWWYQRMIEPALANRQALAEPATAPFGVKAADTVGNMLGLLAQVALTGPAGAEAQTA
EAAPGVAQAVGQTVAHGARAMAFPALTSAVNTGKDVYDQTGDMAQAIKAAQMSYATTTLG
GIVPLGAEGSLAYRLATGAASGVATGEVSRQAMNLVMPQQEGFDPEQTILSGLSGAMLSG
VMGRSPLHDAVQQAYQVGLDAETAERGGATVQQISQIAQASKLRTHDPEAFRNYVQQVSE
DGPVSNVYVDGKMLADALHQSAVDPSQIPGLPDRLNEAVATGGDVQIPIADYATHIAGTD
LDKVILPELKTEEGGMTYSEGQAFYQNARDEMQERANGVVDETTNAGTTQKELGDISDSL
TSQIAATGRYPANVGRASIEPAVQFYRTMSERMGISPAELFDRYPLRIVGEDMGVGLQQS
ERGAFNPDTNTIALLKDADLSTALHESGHFFLSTLGDLAGREDAPQQIKDDMQSFLTWAG
GKDLADWQGRTLEQQRTMHEKFARGFESYLMEGKAPTIEMQSLFSRFRSWLMNVYRNMTA
FHGAEPNDEMRGVFDRMLASDEAIQRAEQVRGYLPLDVKAAGASDAQQAAYARQGEQATQ
DAIRDMQAKSIKDMQWMSKARGKIIREMQRQHDVLRDEVREKVALEVMDQPVNLARTFLE
TGESTDPRTGDRVSAEEGYKLNSDALKRMYAEDTYPPDLTKLRGLTAKGGMHPDDVADLF
GYRSGDDLVRDLINAEKPKAATERLTDERMLQEHGELTDPQAIEDAANLAVANHARARFM
ATGLKILSNSDIPATELAKAAQATAERMIAGKRVLELNPRQYEVAEAKANREAITKAPKD
PKGAVESQRQALLSNRLARAAREAQAEVDKIVAEQKQYDKASIRKKMDLDVLEQIDALRE
RFDFRRNPPDENQKTAGQKSLSMWIRSQQDLGYSPLVNPDMTNPAVRMPYREMTVEQIRG
FRDTIHSLETIARARKSVTVEGQQRDLASVVDELVAKMKEKPDQFQIEDLVEKPRSGVDN
PMKVALDRVSSFLRATAAELKPQQFKANQFDAQEILGPFTRTMFDRVFSANYQKVDMLKS
LSDYFGNAVKEKLGQEWQDRLTEEVPNNRLLDADLSKEFGPKVYRRLTRGDMLGIARNVG
NESNFEKLTKGMDWDPRDVWLFLHDNMTEKDWQATQITWDAFEQHWPEMVEMNKRLGNTS
PDRVEPRPFQTKFGEMKGGYAPIDYDPIRSRLGARKQDSAAIDPSEGLFGKGYYRADTTT
NGSLNGRIEGYFDRVNLDYHSLEKRLHDTVHDLAYREALIDVHKILMNRDFAKQFKLSNG
PEQYKSMQRWLGNLANSQNMEDKSSRLVAIMSSARRAIVANGIALRISTVLKHGGSAALK
STGYFSGGGQKYFAARMAAIGLNHSAEVEGAIEKFPEIRARLMQQDRDYRQTSASLFQPE
SLHAKAERFGHSMVAWSDMMTAVPTAWAAYDRAITEGIPKNRGGTGQPMSEADAISYANQ
IVREAHGSNIEASRSMILAERNEAIKMFTTLYGFMNNTLGQNMDIVDKLRTNGFSKPEVL
SRYLMAMIVPALWAGVLAKPDKKEGVAKWAMGAIGGEYASMVPMMRDAWSAIQGYSSAGM
PAYMSALGAIAKPVEDIVKSVEGKPVKAPIKDFGNAIGLAIPGAGQVGTTIQYAADVKSG
KQQPKNVVDVARGLALGQGNQ

BLAST