GenomeNet

>tr:A0A1N6PVF5_9FLAO [A0A1N6PVF5] RecName: Full=Ferrous iron transport protein B {ECO:0000256|RuleBase:RU362098};
MQHSQKKKVLLVGNPNVGKSTVFNALCNKKQKTGNYAGVTVASHSGHYSFKNEEVEVIDL
PGSYSIYPSSEDEAIFSKFLIDEQKNYAGVIYILEALSLKRGLLLFQQIQDMGIPMILVV
NQIDQAERRGITIDIQKFSEALDITIIQTNAKEQIGINEIKEAVLKNQFVKAEKISFETP
NEHKNFIKKVASHNGLDNEYKAWMSLSLGTDLERIESVMELMNEPDSKTLVPKRLQVQET
VRRYQSVDKILSNVISKKPQFKELLTEKLDKVLVHKFWGYVVFLMILLIIFQSVFFLAEY
PMSWIDDLFSWMTTFISEHLPKGPINSLISNGIVPGIGGIVVFAPQIGILLYFLYLLEDS
GYMARVVFLMDRLLRPFGLNGKSIVPLVSGTACAIPAVISTRNIENLKERLLTILVTPFM
TCSARLPVYSIIIGLIISDGTFLGIKYKALVLMGMYLLGFVVALLSASVLKRFIKNKGKT
YLVMDLPTYKKPLFRYDFKMVLGKVWDFITGAGKIIFIVSIIIWFLSYFGPKQKPDQFVA
SNVHLDHSYLAKMGKGIEPLIAPLGYDWKMGVGILTSFVAREVFVGTMSTLYSLEDDAPE
VKVIDKMRRDEKPNGEKVFSFATGVSVLLFYAFAMQCVSTLAVVYRETKSWKWTGLQVVM
MTGLAYFVSMIAYQILK

BLAST