GenomeNet

>tr:A0A1Q6ZWJ9_9CHLR [A0A1Q6ZWJ9] RecName: Full=HTH luxR-type domain-containing protein {ECO:0000259|PROSITE:PS50043};
MISARENRGFSMVHRTRPTVKSGRLYQLEREGDPIDVGTPPWYDWLEEHDSFLFVDHVGA
VTVRKNETGHGESEWRASRTRLGKVFTVSLGPSRAINLSSLQIAARRLAGKQAHVGSAML
STASPAASTLPIPQTAATSGSLRSLMRAKLSRPRSGSDVIFRTRLIERLNAALGGEITLV
CAPAGFGKTTLMAQWVQTLDRPSAWLSLDEHDNELPVFVHSLAAALQTAFPEAFGATAAL
LKAPRIPPPEHIAALLINDLADVPDDVILVLDDYHCIHNREVHTLLELLVEHLPPQLHLV
LISRSNPPLPIVRWLAKGYLTELRGSDLRFTLEETESFLTRMLGSEAARETAGALDERTE
GWIAVLRLAALSLRGTSDHASFLQHLDSYAARSISSYLVGEILAQQAPAVQEVLERTSIL
EQFCPELCAAVIGSDISHEQVQATLDWLERANLFLVPLDKRQGWYRFHHLFQGLLLQRLQ
THWSQQELATLHQRASAWYAKQGLIEEAIEHARVAGDASEARQLVEAQFFRAFEQEQLVL
VEHWLHLLPEEQIQRSPFLLVARAWISQAHGQLQELPPLLVAAEQLVARGDPDTSEADDP
PFRLLRGLTATLWSLFHFFTGQTQASLESARSALAWIPPAEEHMASHATFYFVLSNQATG
QEEGALAAVQQALRDQSTGLSSTARLLYAQSYVYLAMGKLPHAEHTARHLLHIAREAELV
ISQNYAHWLLAVVHYEQNRLDEAAYHFSAIIANQHQAHFWVVQDALCGLALTYQAQGLGI
QAQETARTLIELVQEQHNMRELMAAFAFRGRLALLQNEVEEADQWLELAGEQDVRGPMFF
LEDPPMTKVRLLLAKGDEVSVARGQVLLTQLLQHVEAIHNTRKTIQVLALQAWAYDLQGR
ETEALDVLERALTLAHPGGFMRTLADLFPLAPLLNALRKGRKARHAADKHLDAYLQGLLA
AMNPVPAQAGSKEDLLEQEGLEPLTRRELQILNLLDKDLTNKEIARELVVTPGTVKLHTK
HVYQKLSVNNRRAAVTLARALGLLAAT

BLAST