GenomeNet

>tr:A0A1Q9DEY8_SYMMI [A0A1Q9DEY8] SubName: Full=G protein-activated inward rectifier potassium channel 4 {ECO:0000313|EMBL:OLP93727.1};
MGDPWQGEAEVSRCDAATRLGQRNLLHASFPTIPKTSNRGEPNSSKYLAAEEAFLEARDV
LEFRDSDSVQFDGVWVQDIQQMLASEPDPEWSVWPAWEDPGTRPQPLQATLRHIEISEFV
AAARNEGTQVQMSHSQRLETQRNRASTAPRYVRPASARGGRTTMPGKSALWPNERMPSSY
KAPLKHVLLVSCRPDEKPWAESKPRPSRFLRRHFALLSKDERAEEWDGQEDDKQEEDEAE
ASLDCSKSVGLLKVAPVATRQVRKISQVRSVKKDLKEMAKSKAALFLSPLPTPNSPPRAV
PGQKQLIAGGVQKDGLWIGGVRLVSREDTGHCTSAASDPLRHNIMSRTFGRRSEKGKDTA
DQDMYHTFLDAKISVQLFSFLVLYVVLFWLYAFIYLFISVSAANPAKTLSDVQLALIIFW
SEHGVPASEEKGRYLLSLETMLTIGYGIPDPYMKGCWQGPFVLTSQLLLNLIISALLIGV
IFQAVRGIARPQSRACTILCSDKAIIRCIDGAYYFMFRVCDLRSQHALVEPHIRCYCVEQ
SDIRGGAAQERREAKPAVEGVAGKVRNHGRFARSPGAAQLGQVSEGGVPIPRANSEVGNG
DSCAPDREGEESNGETFTCYIPKAETLKRHCRYNAAQDEISQLPEKEQEQEQEQEQEQEQ
EQEQEQEQEQEQGQEQPQQQQQGDPTKEDIGSWAEAGAYLGKSFKEVVVGPPEATDTDTA
WDMDFVDCIMVPEDEDRV

BLAST