GenomeNet

>tr:A0A1S1XB72_9NEIS [A0A1S1XB72] RecName: Full=Type 4 prepilin-like proteins leader peptide-processing enzyme {ECO:0000256|RuleBase:RU003794}; EC=2.1.1.- {ECO:0000256|RuleBase:RU003794}; EC=3.4.23.43 {ECO:0000256|RuleBase:RU003794};
MLQDMAWLLATHPAYLLGAAVVLGLMVGSFLNVVIHRMPRMLENEFLADSVGYLAESDRF
PALKLAAQGAMEELTEAPGYNLWRPASHCPSCGAAVRAWQNIPLLSYALLRGRCAACRVG
ISPRYPLVESLCGVLFGFLAWKLGWGWPLFGAMALTAALLALTFIDLDTQLLPDSLTLPL
MWAGLLFNLHGGLVPLSDAVLGAACGYLSLWLVYQLFKLATGREGMGYGDFKLLAALGAW
LGWSMLPLIILLSSLVGAVCGLAMMAASRVGRGQPIPFGPYLAAAGWIALVWGPQIVEGY
LAWLSR

BLAST