GenomeNet

>tr:A0A1S3MLM1_SALSA [A0A1S3MLM1] SubName: Full=inositol 1,4,5-trisphosphate receptor type 2-like isoform X1 {ECO:0000313|RefSeq:XP_014003726.1};
MSDNRSSFLHIGDIVSLYAEGTVNGFISTLGLVDDRCVVQPDAGDLAIPPKKFRDCLFKV
CPMNRYSAQKQFWKAKQGKQGNNDTEADLFKKLQHAAELEQKQNDTENKKLLGEVVKYSN
VIQLLHIKSNKYLTVNKRLPALLEKNAMRVSLDPSGNEGSWFYIQPFWKLRSEGDNVVVG
DKVVLMPVNAGQPLHASNIELLDNPGCKEVNAVNCNTSWKVTLFMKFSDYREDVLKGGDV
VRLFHAEQEKFLTCDEYRNQQHIFLRTTLRQSATSATSSKALWEIEVVHYDPCRGGAGQW
NSLFRFKHLATGSYLAAETNPDFRDESVDSKAEVSQTETDTVFSQRKRQAAEKIAYTLVS
VPHGNDIASLFELDATTLQRADCLVPRNSYVRLRHLCTNTWVTSTNFPIDTEEERPVMLK
IGTCRTKEDKEAFAIVSVPLSEVRDLDFANDANKVLELTVRQLQCGNIAQNDRRFVTKLL
EDLIFFVCEVPNNGQDVLSVVISNPNRERQKLMREQNILAQIFGILKAPFTDQGEGPMLK
LEDLGDQRYAPFKYMLRLCYRVLRHSQQDYRKNQEYIAKKFSIMQSQIGYEILAEDTITA
LLHNNRKLLEKHITAKEIETFVNLLRRNREPRFLDYLSDLCVSNKTAIPVTQELICKFIL
NPANAEILIQTKLIPSMETTLQSSMLQEDTEEDEEVWLYWIDSHKEPHGKSIRHLAQDAK
GNHKLDNDVITYYRYQLNLFAKMCLDRQYLAINQVSSQLPVDLILRCMFDDCLPYNLRAS
FCRLMLHMHVDREPQEAVVAVRYARLWTEIPSKITIHEYEYEFTDTSREEMKRKFAPTME
FVEEYLKDVVSQPFPFGDEEKNELTLEVVHLARNLVYFGFYSFSELLRLTRTLLAILDFV
QHPLTDMAELSKSPEAGNNVFRTIHGVGEMMTQMVLSRGHVQPHHLPNTPPSLQDRKQPL
CLTDNEDVMVMDTKLKIIEILQFILSVRLDYRITYLLSIYKKEFGDSNLPDSSMSLSEFP
SMSVSDPDIDEIAAKAETMFAGSSECSAVELDDEGGRTFLRVLIHLIMQDYTPLVSGSLQ
LMFKHFSQRAEVLQAFKQVQLLVSEQDVENYKQIKTNLDQLRLAVEKSELWVEKSGGYGN
EDIGDSQVKEQTMEEAGILSPVQDGDVKPHIDSNKANNYNIVKEILLRLSKLCYPSKKSC
VQQQRLLKNMGAHSVVLDLLQIPYEKSDAKMNEIMTLAHVFLQYFCRGNSQNQALLHKYL
NLFLSPGLLEAETMRHIFMNNFHLCNEISDRVVHHFVHCIETHGRHVQYLKFLLTIVKAD
GKYVKKCQDKVMTELVNGGEDVLVFYNDRSSFPVLFQMMCCELERRDEDGALAYHNTLVE
LLAVCTEGKNVYTELKCNSLLPLDDIVKVVTHEDCIPEVKTAYVNFVNHCYVDTEVEMKE
IYTSHHIWKLFENFLVDMARVCNSTTDRNHANVPLERYVTETVMAVVKGFFSSQFPVNNS
NLQTHQPIFIQLLQSSFRIYNCTWISSAQKNNIEGCIKTLADVAKARAIAIPVDLDSQVN
TLSLKAHTYRVERAVKDWRTSARTRLRKEILGVPDYKSIIEKLQGVVACLEEQFSPMVQA
EFSVLVDVLHSPELLFPEAARLRCESGAFMSKLIKHTKKLMDKEEKLCIKILQTLREMLV
KKEAFDEPGNVLRKILLTRYFGKKRLHSKSEFGSGNSSAGGGSLVQDSDKLSSSMVDIQC
LLDSEGASELVIDLIVSTKNDCMFEESILLGNALLQGGNTQIQNSFYHQLHKQKKSEHFF
KVFYDRMRLAQQEIRATVSVNMFEVSTCRKRDEDVDVSYSGIRLRKTPKDSSLHMVDNMR
GQLKEASSATSKAFVSFRKERDTDLEVLEGQAGEGPGGGAEEREEEAQMSRAITIMKPIL
RYLQLLCENHNRDLQNFLRNQNNKTNYNLVCETLQFLDIMCGSTTGGLGLLGLYINEGNV
DLVRQTLETITEYCQGPCHENQSCIAKHESNGIDIIIALIVNPVNPLGKHRLDLVLELKS
NASKLLLAIMESRHDSENAEKILYKMRPMELVDVMKEAYAQGLESEAEENAIGDQIKPKD
VGHNIYILAHQLARHSKFLQQSLRPPATGLLLSHKIEGEDALSYYANHTAQIEIVRHDRT
MEQIVFPVPNICEYLTEESKTRVFTTTERDDQGSKVNDFFTQFDDLYNEMRWQKKIRNNL
ALFWFSRHISLWGSISFYLAVLVNVAVALFYPFGDGEDEGILPPFVSILLWVALVVCTTM
LFILPKPGSVRPFLVSVILRSIYTLGLDPTLLLLGAANLLNKIVFLVSFVGNQGTFTRGY
KPVVMDMPFLYHVGYVIVCMLGLFVHEFFYSFLLFDLLNREETLLNVVKSVTRNGRSIVL
TAVLALILVYLFSIVGFLFLKDDFRMDVQRLPVMAGEDDGTERVCDTLLMCIVTVLNQGL
RNGGGVGDVLRKPSKDDPLFVARVVYDLLFFFIVIIIVLNLIFGVIIDTFADLRSEKQRK
EEILKTTCFICGLERDKFDNKTVSFEEHITSEHNMWHYLYFLVLVRVKDPTEYTGPESYV
AQMIKEKNLDWFPRMRAMSLVSSEGESEQNEMRSLQEKLDGTVKLVSLLSSQLFELKEKM
TEQRKNKQRLGFLGTHGVNNHHIPAH

BLAST