GenomeNet

>tr:A0A1S3SB60_SALSA [A0A1S3SB60] SubName: Full=ryanodine receptor 3-like isoform X4 {ECO:0000313|RefSeq:XP_014061575.1};
MAEGGEGEDDIQFLRTDDEVVLQSVATIQKENRKFCLSVEGLGNRLCFLEPTSEAKYVPP
DLCICCFILEQSLSVRALQEMLAHTVPNNEGKADHEQWAAQGGGHRTLLYGHAILLRHSF
SGMYLTCLKTSRSLTDKLSFDVGLQEDSIGEACWWTIHPASKQRSEGEKVRIGDDLILVS
VSTERYLHLSISSGSFQVDASFMQTLWNVQPTCSGSNVAVGFLCGGHVMHLCHGHDESLT
IPGSEASEMEQRIVNYEMGKGASRARSLWRLEPLRIGWSGSHIRYGQAFRLRHLSTGQYL
ALTEEHGLVLQEREKSDTKSTSFCFRATKEKIESGTKNRDIEGMGVAEIKYGDSACFVMH
VATGLWLSYQAPDAKASRIGPLKRRACLHAEGHMDDGLTLQRCQHEEARAVRIIRNTTVL
FSHFIKGLDSIGRDKNVEVSLPNFDEVLQTLDDLIEYFKQPDSELEHEEKQTLLRSLIKR
QDLFKEEGMLALLVMCIDRLNLYNSAAHFGEHAGEEAGAAWKNILNLLYQLLASLIKGNR
NNCTQFSRNLDWLVSKLERLESSSGILEVLHCILIESPEALNIIQKGHIKSIISLLYKHG
RNHKILDVLCSLCVCNGVAVRANQNLICDHLLPKRDLLLQTRLVNDVQSMRPNIFLGVAE
GSAQYKKWYFELMIDQVNHYVTSEPSHLRVGWASTKGYAPYPGGGEGWGGNGVGDDLYSY
SFDGLYLWSGRISRAVASINQHLLNSDDVVSCCLDLGAPSMSFRINGQPVQGMFEDFNTD
GFFFPVVSFSAGVKVRFLLGGRHGDFKFLPPAGYSPCYEALLPKEKMRVEAVKEYKRDYG
GVRDLLGTTQFLSQASFIPTPVDTSQIVLPPHLDNVRDRLAENIHELWGMNKIELGWCYG
KVRDDNKRQHPCLVDFTKLPETERNYNLQMSSETLKTLLALGCHVTQTNVNAEEDLKKVK
LPKDYVMSNGYKPTPLDLSEVKLTAGHEVLVDKLAENAHNVWAKERIKQGWTYGIQQDVK
SRRNPRLVPYALLDERTKKSNRDSLREAIRTLVGYGYNIDPPDQEPCHIVEKQSIETIRF
FRVEQTYAVKTGKWYFEFEALTGGDMRVGWARPGCRSDFDLGMDDQAYVFDGYKGRRMHM
GARFFGQSWNEGDVVGCMINMEDKSMVFTLNGELLITNKGSELCFVDFETDDGFIPVCCL
AQSEIGRMNLGKDASSFKYYTTCGLQEGFEPFAVNMNREVTMWFSKRLPTFVNIPKDHNH
IEVTRIDGTVDNPPCLKVTHKTFGTQQSNSDMLYCRLSMPVELHAPHVSPDESQKLSQPP
KEDDYGRITTYYHSVRVFAGQDPASVWVGWVTPDYHYHSKQFSLNKTRTVTVTLGDERGR
VHESVRRSNCYMVCAGDVVGSSHSSSRSNIDLEIGCLVDLATGFLSFTANGKELATTYEV
ESNTKLFPAVFVRPTSTNLFQFEFVKIKAAMPLSSAIFKSEQRNPVPQCPPRLDVQTIVA
VLWSRMPNTFLTVETARVSERHGWVVQCLEPLQMMAVHIPEENRCLDILELSENEGLRKF
HYHTLMLYCALCALGNTRVAHALCSHLDQSQLLYTIDNQYLSGMLREGFYNVLMSIHLET
AKEARLMMNNEFIIPVTDETRSIKLFPDESKRHSLPGVGLSTSLKPRLIFSPLSFITTKK
QQHLHSPQIPLGILKEKAISMLTEAVQGGGSHIRDPVGGSVEYQFVPILKLIGTLLIMGV
LTSEEVRLILLLIDPNVFGEPEEEEVEAASAGGGEKEEVSSNEEKAVEAGEEETKDVKPT
VKGLLEKTLPESVKRQMCELLHYFCDCELKQRIEAIVSFSDSFVSKLQYNQKFRYNELML
ALNMSAAVTAKKTKEFRSPPQEQINILLNFAAGEDCPCPEEIQEDLYKFHDELRLHCGIP
VEEEEEEEDTSIKGRLLAMLYKIKGPPKKLEEEPTEEEQAAPTNLKELISQTMASWAQEC
SIQDPELVRVMFSLLRRQYDGIGALLRAMKKSYTISAVSVQDCVNLLASLGQIRSLLSVR
MGKEEEKLMIDGLGDIMNNKVFYQHPNLMRVLGMHETVMEVMVNVLGGDKSQEIAFPKMV
ASCCRFLCYFCRISRQNQKAMFDHLSYLLENSSVGLASPAMRGSTPLDVAASSVMDNNSL
ALALEEPDLEKVVTYLAGCGLQSCAMLLAKGYPDIGWNPIEGERYLSFLRFAVFSNGESV
EENSNTVVKLLIRRPECFGPALRGEGGNGLLAAMLEAIKISEDPALDLPSTADGEPSGSD
EEEEVAHTGNAIMSFYSALIDLLGRCAPEMHLINKGKGEALRIRAILRSLVPTTDLVGII
SIPLKMPIVNKDGSVTEPDMSASFCPDHKAPMVLFLDRVYGVEDQSFLLHLLEVGFLPDL
RASASLDTDVLSTTETALAMNRYIGSALLPLLTRCADQFSGTEHYAALIDSTLHTIYRLS
KGRSLTKAQRDSIEECLLAICKHLRPSMMQQLLRRLVFDVPLLAEYCKMPLRLLTEHYEQ
SWMYYCLPSGLGSSGMASEEELLLTKKLFWGIFDSLSTKKFDSDLFKTAMACLSAIAGAL
PPDYMDASPGVTLEKQASVDAHGNFDPKPINTANMSLPEKLDYIANKFAEHSHVKWSSEK
VTAGWKMGECVDDDAKTHPLLKPYKSLSEKERETYRWPVKESLKSMLAMGWNMERTKEGE
AMLIRKQSKISESTQDNDNEFIPEPPLDLNNITLSRELQGMVEVVAENYHNIWAKKKKAE
LNSKGGGSHPLLVPYDTLTAKEKYRDREKVQDLFKFLQINGYTITRGLKDMEQDSSSMEK
RFAYTFLKRLLKYVDSAQEFIAHLEAMATSGKTDKSPHDQEIKFFAKVLLPLIDMYFKNH
SMYFLSSPSKNLSSSGYASNKEKEMITSLFCKMAALVRHRISLFGSDSAIMVSCLHILAH
SLDTRTVMKSGSEMVKAGVRTLFENAAEDLEKTLEMLKLGKFSQSRSQMKGLSQNITYAT
TALLPILTALFEHVTMHNFGVCLLVDDVQLSCYRIVTCLYSLGTGKHIFMERHLPALGEC
LATLVGAMPVAFLEPDLNAHNPLSVFNTKTQRERAILSMPDSVEEMCSDMPRLDRLLKDI
NDISESGARYTEMPQVIEVILPMLCNYLSYWWERGTENSAPHTACCTTVCSHHLSIILGN
ILKILNNNLGIDDAPWMKRIAVYSQPIICKAAADLLKSHFLPTLEKLRKKTVKVVAEEEL
LKADIKGDTQEAELLILDEFAVLCRDLYAFYPMLIRYVDNNRSRWLKRPDAQSNELFTMV
AEIFILWCKSHNFKREEQNFVVQNEINNLSFLTGEHKTKMSKSGGDQDRKHKKRRGELYS
VQTSLIVAALKKMLPIGLNMCTPGDQELISLAKIRYSLKDTDDEVKDHLRENLHLQDKSD
DLAVQWQMNLYKDVVVVGSEEHADPEQTVDRIQSISAAVFHLEQVEQPLRMKKCVFQKLL
SKQRKRAVVACFRMAPLYNLPRHRSINLFVLGYVRLWIETEEYSFEERLVQDLAKTPMKI
VEEEEEEEVEIQPDPLHQLILHFSHNALTERSFLEEDPLYIAYADMMAKSCAEDEEEEEE
EEGKEKTFEEKEMEKQKILYQQARLHARGAAEMVLQMISASKGRLGPMVTCTLKLGISIL
NGGNVLVQQKMLDYLKEKRDAGFFKSLSGLMQSCSVLDLNAFERQNKAEGLGMVTDEGSS
SKVLTNDDFTKDLFRFLQLLCEGHNGDFQNFLRTQTGNTLTVNIIISTVDYLLRLQESIS
DFYWYYSGKDIIDEAGQVNFSKALAVAKQIFNSLTEYIQGPCIGNQQSLAHSRLWDAVVG
FLHVFANMQMKLSQDSCQIELLKELMDLQQDMVVMMLSLLEGNVVNGTIGKQMVDTLVES
SSNVEMILKFFDMFLKIKDLTTSDNFREYDPDNKGVISKKDFQKSMENQKQYTQSEIEFL
LSCAEADENDMFNYEEFVERFHEPAKDIGFNIAVLLTNLSEHMPHDPRLATFLEPAESVL
NYFEPYLGRIEIMGGGKRIERVYFEISESSRTQWEKPQVKESKRQFIFDVVNEGGESEKM
EMFVNFCEDTIFEMQLASQISEPEVVERPEEEEEEVHNLLEELAEQEEERELEASSAFTM
VCVSAKKKISNFREMLTFKSLKKQYKKSKKLSMKEVILGFFSFFWTLFAGFFKGIYSLIF
GFFHLIWSSMFGGGLVEGAKNMKVTDILGNMPDPTQFGIHGDVLETEKVEVSDSVSGGTD
QAIKPSDKAEQDILMEMINPMPKKGEGLKHVDPGLGDVSENLTAETTATVEKKNAASEPT
ESEPEKADTEKKEKEDKVKVEQPKEEMAQDKPVLKSRNGQSKEAPTSFFASFLAGLEVYQ
AKMLNTLARNFYNMRFLALFVAFAINFILLFYRVTAAEDDEDDSWTSSDDEDEGGEEYFV
LEESTGYMAPILCFLAVFHTALSILCLVGYYFLKVPLVVFKREKGIARLLEFEGLYITEQ
PADDDIMGQWDRLVINTPSFPNNYWDKFIKRKVINKYGDLYGAERIAELLGLDKSALDFD
PTQETVVEAASLVSWLSSIDTKYHIWKMGVVLTDNSFLYLIWYATMSILGHYNNFFFAAH
LLDIAMGFKTLRTILSSVTHNGKQLVLTVGLLAVVVYLYTVVAFNFFRKFYNKSEDEDAP
DMKCDDMMTCYLFHLYAGVRAGGGIGDELEDPAGDPYELWRILFDITFFFFVIVILLAII
QGLIIDAFGELRDQQEQVKEDMETKCFICGIGNDYFDTTPHGFETHTLQEHNLANYLFFL
MYLINKDETEHTGQESYVWKMYQERCWDFFPAGDCFRKQYEDLLG

BLAST