GenomeNet

>tr:A0A1S6IMR3_9LACT [A0A1S6IMR3] RecName: Full=Cell division protein FtsL {ECO:0000256|HAMAP-Rule:MF_00910};
MATSEYAEQVYNQAVEIQNPNPNPHPVPVNPTVTAPRRKYKKWSKEITALVAIMITAIIL
VFLSLLTQVTISNQNRQLQDLQDRSLVISMENDNLSQEVQELSQYSRIMEIAETMGLEMN
EANVRNVMR

BLAST