GenomeNet

>tr:A0A1S8DBW3_9PROT [A0A1S8DBW3] RecName: Full=DUF2075 domain-containing protein {ECO:0000259|Pfam:PF09848};
MRAWFACTGAELLRTEAADVAARLAAAQTRRGFDATYAQLAAWEASASLLREAVVRAGGE
GWTLAFEYELLRLEKRIDAVLLTDRAILVLEFKGEGFSPADLRQVEDYALDLRDFHAGSR
AHPIVPVLVPLLAPDQGAQQLSLLWHAVVPPLRANARGLPALLSAVQASVPAPATPLDGA
AWLAAPYRPVPSIVEAATMLYARHGVAEIAAARSDAANLTRTTEAIARALDEARRDAARV
VVFVTGIPGAGKTLCGLNAVFGTARLDGAAFLTGNVPLVGVLRAALAQDAVARGACGRDE
AERRVKAALQNVHAFLAEHAGDPRHGPPPERLIVFDEAQRAWDAKQASRDTQRRKAVLTL
SEPAHTLEIMARTEGWSAIVALVGQGQEINTGEAGLAEWGRCIAADGRWRAVAAPHVLEA
SDPVQRLAPGPASWLRLDPALDLTVPIRGIRSAAVAPWVEALLDGRVAEAARIAAEAEGG
LPVFLTRDLGTLRRTLRAFARGERRAGILRSSGARRLRGDGFGEEVPAPAVADWFLRRWP
DVRASDALETGATEYACQGLELDVAGLAWGGDFLPAGASGWQARRFVGSAWQVVRQAQER
DFIRNTYRVLLTRARYETVLWVPRGDAADRTRDPAALDLLAARLLRCGARSLDEASMEPP
EQEMEDAPSLL

BLAST