GenomeNet

>tr:A0A1U7XFW0_NICSY [A0A1U7XFW0] SubName: Full=beta-galactosidase 17 isoform X1 {ECO:0000313|RefSeq:XP_009789763.1};
MVKMGQIENEFGSYGDDKAYLHHLARIARRHLGDDVILYTTDGGSRENLNKGTIPGDTVF
SAVDFTTGDDPWPNFKLQKEFNAPGKSPPLSTEFYTGWLTHWGEHIANTDATVTATYLER
ILSRNGSAVLYMAHGGTNFGFYNGANTGADESDYKPDLTSYDYDAPIKESGDIDNPKYQA
LRRVIAKYTAAPLASVPPNNEKKAYGLIKLQKTKSLFNIIDTKYFDGVTESEDPLAMESL
GQMFGFMFYVSDYKAKANGSLLFIPKVRDRGQVFISCPSNSNEEIPKYVGTIARWSNTPI
RLPHTQCSSGSKIYILVENMGRINYGQYIFDKKGILSPVYLDGEPLHKWKMLPIPFHNLN
EDQQINSVISDAYTNLGNSVRKNLKNRINYHPEPAFYAGHLTVDEVKDTFLSFRGWSKGV
AFINGYNIGRFWPSFGPQCNLYVPAPFLHKGKNLLVILELEVPNAELFVTSVDQPDFTCG
SANSKVHQI

BLAST