GenomeNet

>sp:A0A1U8MLH4_GOSHI [A0A1U8MLH4] SubName: Full=uncharacterized protein LOC107937888 {ECO:0000313|RefSeq:XP_016726368.1};
MAKKEEMRLRKAITFSSCGSEPDELRRMALKASKSLKSDRPLSRQLSMCEASRDIAWERR
RQQMLKQQRERKGIDVTDGKKLTDEDLHELKGSIELGFGFEEEQGQKLCQTLPALDLYFA
VNRQVSSSPVSSPHGGGPAFTPSCNEFESPRSILDWKICNPGDNPQQVKTNLRHWAQAVA
CAVMQSY

BLAST