GenomeNet

>tr:A0A1U8PMH4_GOSHI [A0A1U8PMH4] SubName: Full=receptor-like protein 12 {ECO:0000313|RefSeq:XP_016752367.1};
MGSHSCSHHEAASLIQFKNSFSITQTGHAALCCDDFASLKSYPKTNSWKEGTDCCSWDGV
TCDHLNAHVIALDLSCSWLYSNFPSNTTLFLLPHLQKLNLSFDDFNDSKTPSEFGRFTSF
SRSSNLEHLGLSWISFSTELIDSVGNLQALKYLDLSGNSFFQRFSVSITNLSSLEYLIIS
EANMCGGLPDSMGNLESLKFLDLSSNELSGQIPLSILNLTQLEYLEIARNSLEGSIPDEN
IAFLDLSSNLICGNLPIPASTIRVFLISNNSFNGEVSSLISNASSLRILDLSHNNLSGTI
LQCFGDLSNYLEFLNLNKNKFYGTIPPTFAKGCQLSNFQLKWKYVRRAFDTILNCKGLEV
LDLGNTKINDTFPHWLGSLPHKE

BLAST