GenomeNet

>tr:A0A1U9RGY7_9GAMM [A0A1U9RGY7] SubName: Full=Capsid assembly protein {ECO:0000313|EMBL:AQU85080.1};
MKASLAASLKASLKYSAITVTLMLGTLVAGAASAQSLSLANSVLPEQSGRSGQNGQQQEQ
VDDTPRADWRSGTYGPVSLPTESLDELPPFGANLFTGGFRGAMGDGLNADYRIKPGDQVT
VRAWGAFELDRVLPVDAQGNIFIPGSGPLHVQGQNSQQVDNSVRRAITSVYPDNVEVYTN
LQGVQPVAVFVTGYVENPGRYAGTPNDSLLYFLDQAGGIDQDLGSYRQIRVVRNDSTVAT
VDLYDFLINGTIARPQFQDGDTIVVEERGPAIAVGGDVHREHRYELTGNQLSGAEIVALA
RLRSGVSHVLLRGDRAEGPIAQYFPIDMFYGQTIRSGDEVLFSADQRSETIVVELEGSYY
GPSRFALPRDARLSELLDAIAVPENMTAVESISLQRESVRQQQAQSLQDSLRRLETTYLG
ASSRTDQEAQIRLQEAELIERFIERARELEPSGRLVVASRDGISDIRLQDGDIITIPEIS
DSVLISGEILVPQAAVYRPGMSVIDYVESAGGFTERADKDHILLVRQNGAVEHARNSPLR
PGDEILIMPRAPTHNLQLASTLAQLLFHIAVTTRVALDL

BLAST