GenomeNet

>tr:A0A1V3SEI4_9BURK [A0A1V3SEI4] RecName: Full=SLBB domain-containing protein {ECO:0000259|Pfam:PF10531};
MPAFLRFAMTFLLVAVSGSAIAQTESAYKLRHGDALMVSVWRDEALRMQVRVLPDGSITF
PLAGRVEVVGLSTPEVEARVAEKLKKYIPVPVVTVAITATDGNQVYVLGKVVRPGAVTLT
SPETTVLQMLSQVGGLDRFADGNSIRVLRNSPQGNRILPVRYDDLVKGSQLDTNVVLVPG
DTILVP

BLAST