GenomeNet

>tr:A0A1V4HNA0_9BACL [A0A1V4HNA0] SubName: Full=Phage shock protein A {ECO:0000313|EMBL:OPH59320.1};
MSLLRRMRDITVASLNEHLERSEDPVRLIDQYLAAQREQLQQSERLYQQCVSHAASLRQQ
YLTALETKEKREHQALLALKAGEEHMARIVLQEKLQAEEKSEQYHELYEQAKQSILDLDE
ELQQLKADYKEVADKRSYYLARMESARLQQRLHARSSVTQDGAPRMFGRLEERVSDMELH
ARTLRDVRRMGRESYYSGGNPAVDAELEALRNKLQQEGAQKS

BLAST