GenomeNet

>tr:A0A1V6LUS3_9FLAO [A0A1V6LUS3] SubName: Full=Trk system potassium transport protein TrkA {ECO:0000313|EMBL:OQD43924.1};
MKIIIAGAGEVGFHLAKLLSYESQEITLIDTDKESLGYADTHLDIRVLRGDATSVEVLQD
AKVEASDLVIGVTASETTNITLCMLAKQLGCKQTIARISNTEFIYNQDILRFNELGIDEL
ISPEQLAASEIQLLLNKSAFSDTYEFEDGLLTMVGVFLPKSAPFVGKSVKEAARVFPELH
FMPIALQRMGTQYTLIPRGDTVFKEGDQVYFVTCQNGVEELLKLTGMQKREIKNVMILGG
SKVGFKTARDLCSKKFNVKIFEKNKEKAMDLAENLPNALVINGDGRNVELLEEESLESMD
AFVSVTGNSETNIMSCLVAKSKGIKKTIALVENMDYFQLSQSIGIDTLINKKLLAANNIF
RFVRRGEVLALTRLNNLNAELLEFEVKPGSYVNGEVIKELDFPREAIIGGVIRKGEGIIA
LGDFRITTGDKVVVCALPKAIAKIEKLFL

BLAST