GenomeNet

>tr:A0A1V8TJC9_9PEZI [A0A1V8TJC9] SubName: Full=Uncharacterized protein {ECO:0000313|EMBL:OQO11404.1};
MIVDYWIARRGNVHVPSLYRPEVGSPYYYTKGVNFRAYVAWVCGVVLVISGISGAIKPDS
ISQTAVNVYNCGFVLSLTAGALVYYTLVKIWPVQIYPTGTHEGDSKAWESMIATEGFFLD
DEPTPEYIKEKVFFGIEPVGTSGLSEGGDMEKAKHG

BLAST