GenomeNet

>sp:A0A1V8TRU2_9PEZI [A0A1V8TRU2] RecName: Full=NACHT domain-containing protein {ECO:0000259|Pfam:PF05729};
MAEAEELTAAVSGFAIGPGPQNLNSGNGQQTNATMSGGMQNTQYIAQAQHFLSPSLETAK
DYLDALFVTDPAVDRDKLERLKGAPIQDDAPHLLHIRGGPGKGKTMLSIYLTGELDLMKR
SILVYYFFMAGDPRRDNATAMMRTLIWQLVNTAAEPQLVNHLSECMVSTVRSKQVMSEPE
TMWKMFTALVGALQQREVYCIIDGLDECISDDQDWIARKLIGNGPDGGLTILRTLGLSRP
TLDLRSARHIDLDGAASPEIASDVRLYISTATTAIADRLDLSEAKRTMLEFDLAERAQGS
FLWISFAISACARKGTYTRLMESLEKMPEGLFGIYRRILDDIEDDCKSDVVRVLQWVAMA
KRPLHVRELAFLLRPTTTAFEEQIELTCDHIALCGPFLQLQEVEAHDWDTLFGNTRFQTL
LQPVPRYRNRTQVNFVHDTVKEYLLNTAEHTGKKGASYLLLLHNPSLNIKNGRGHTAFDH
AAWTNHKAAGLLVAARESEPTDLAERWERVRTAAVHAHLADYEVDLAHEAANPVIPTDEA
PVIDWVEWMTQEMEDLNTTKQSLILRFGNSEDTGAKES

BLAST