GenomeNet

>tr:A0A1V8V2E8_9PEZI [A0A1V8V2E8] RecName: Full=RPN13_C domain-containing protein {ECO:0000259|Pfam:PF16550};
MAANPLITFKAGKCTFSGKKVTPVPTPGYLYLYFEDDMPHFCWRPRSQPASHPEIDLFMV
PGDGSFEPLPREYGAEELHSPTNGRIYTLKFQSSSQKHFFWMQSKSQHADGTPSWFSQRD
QRLGQIVNSILQGEELDMEAEVADLRNGGGGGGADGDGDDEMDVDEHPPEHGRHPSTGGA
GQGATGGDPREEGSASREGGGDGARALSSQPSSQDPSAVVQNFLKSLQGSSQNTPPPPPS
GADKPYTTLSDLLTPSQTIPYISTATPAQLDNLCAFLPPELFTLSQESSSTPDHATHTSA
ADASAAIDALSTEQKREILIRVLRSPQLQQSLGSLTVALRDGGLPIVSEALGLKVKNGGN
VRHASVPLGGGEAVEAFVDGVRTTVEEEEKSKS

BLAST