GenomeNet

>tr:A0A1W4VKT9_DROFC [A0A1W4VKT9] SubName: Full=DNA-binding protein D-ETS-4 isoform X2 {ECO:0000313|RefSeq:XP_017052696.1};
MPHSPQLKPHQFQAQTSPDQYSAYADNFDLSLLPQESAPIPTTVFQYNAPQIKVECAWES
QPVQQQPQQQPPIAPFASSSHQLIPPPAYPHSAYPSPQSSPLQSEFAAFGFGRFGGSYDS
LNSPSPSLEAVSIKQELHILPPSPPESNCETPSPRSSCGESIKAEPLDADIESLIDLNSL
LQQQSLQDTKPDHQLLRECLEDTSFQKRHNLKPLALESFIGGLAEVRGDFEPVISLALEH
AKREADAICAELQISQDPNGWSPAQVHAWLRSTLAQFGLPPVADLELHFCEDGAALTLLS
EEEFVRRLPESGSTLHAQLEIWKMAYADQPTNQQQQQQSHQPANADLWPASYAMPNLELD
FNEDSEDDEDMEADATITPLTSSSTSSAAATPTTGGTATAKRPNGGRTGGGGSHIHLWQF
LKELLASPQVNGTAIRWIDRSKGIFKIEDSVRVAKLWGRRKNRPAMNYDKLSRSIRQYYK
KGIMKKTERSQRLVYQFCHPYSQ

BLAST