GenomeNet

>tr:A0A1X2ABN7_9MYCO [A0A1X2ABN7] SubName: Full=Uncharacterized protein {ECO:0000313|EMBL:ORW48265.1};
MSRLSSGLRAGAIFTALGIAATIFPNIAAADSTEDFPIPRRMIATDCDAEQILAATRDTS
PVYYQRYMIDFNNHPNVQQATIDKAHWFYALSPADRRTYSENFYTSQADPLWLAWPNHMK
IFFNNKGVVAKSTDACDQYPKGDMSVWNWA

BLAST