GenomeNet

>tr:A0A1X2IPF6_9FUNG [A0A1X2IPF6] SubName: Full=Thymidylate kinase-like protein {ECO:0000313|EMBL:ORZ19918.1};
MRGYFVVVEGCDRSGKSTQCERLVDRLQSQGKAVQLFKFPDRTTQTGKMIDSYLKQSTQM
DDHAIHLLFSANRWEALAHMKSLLEQGTTIIVDRYAFSGVCFSAAKGLDFEWCRQPDIGL
LTPDVVMFLDLSMDEAEKRGGFGDERYEKRDLQLRVRQEFNKVMDSTWKTIDASKSRDEV
HDDMMTVVEGLSPNPGPLRQDLWMDLAK

BLAST