GenomeNet

>tr:A0A1X7LTJ9_9BACL [A0A1X7LTJ9] SubName: Full=Phage shock protein A (PspA) family protein {ECO:0000313|EMBL:SMG57155.1};
MSGIFRRVRDITLASLNEHLDRAEDPIQLIDQFLMRTQQEINESERLYKQYVMHANQMKQ
QMNQAVELRDRREQQALIALKANEEYAAKLALQEKLMHEEKAQHYTELYNRTKDSILELE
QQLHTLKGEFQTVYDKRQLYIARMQTIRLQQRMNERTNHFGGNQTDGMFRRLDDRVTDME
WETQSLNNIRHMNQNIQGSYEKEAQLQQEMQRLREKLNTPKE

BLAST