GenomeNet

>tr:A0A1Y1ICV4_KLENI [A0A1Y1ICV4] SubName: Full=Thymidylate kinase/adenylate kinase {ECO:0000313|EMBL:GAQ88740.1};
MAEAEAGPSRGAFIVLEGLDRSGKSTQVQKLVEYLKSRGVEAEAWRFPDRTTAMGKMIAS
YLDSKSELDDCAVHLLFSANRWEKRSLMEAKLREGTTLIVDRYSYSGVAFTAAKGLPFDW
CKAPEVGLPAPDAVLYLQIPPEAALERGGYGEERYEKLDFQRVVASKYEQLRDATWQDID
ARKGPDEVQAVLRPIVDRMVQTCKQGRPLSRLWP

BLAST