GenomeNet

>tr:A0A1Y3FXR1_9PROT [A0A1Y3FXR1] SubName: Full=Uncharacterized protein {ECO:0000313|EMBL:OUI87816.1};
MKFSAYIIAASLLLGSVTSAYANAYDSISVYAIEKSHGSIATGSNTAYVKTYNITISNLS
DTEADLSKICLKAYSAENKELRLDTVDANLVTGFLKKGQPATGTAIFASHDDIISKPVIV
KLSDNCNFVRISR

BLAST