GenomeNet

>tr:A0A1Y4GNW3_9BACT [A0A1Y4GNW3] SubName: Full=Uncharacterized protein {ECO:0000313|EMBL:OUO94740.1};
MGIYDEVRSRTGNSGIMVGPALSADEAHALGLSSVNPLVDELERSYERYVTENPDEAAAR
AWNAERVGVPLWVQERSDKYANEAKKRLALLEKGTPDWKKLADASPVTASFMTGDGVMAS
AHDDVQGLADIEDVTHSLSYLRLNYKDKLAYLRNERIVPRLSVPTLDVKDRPGMLASLPL
LNPRAIGRGGWDGLSEEELVRLRDKPVSQTVAEAVRAIDSWASDTSFGKGITSGYEMSAI
GTEAHNLFLANSLGRGSEAQWVELEKRVLALDREKPEGWLSGMLYETGKFIGQQAQGAWT
SGLMSAAGAGLGAYAGSLGTAAFAGSVLNPVGGAVLAGAAAGWWLGTKAGVFTQASKTEM
GLDLIERRMMRGADGEYISNFAAGLGSLAVGAVNGALELTEWTVAGRPFTGVARRVVSPA
VMKSVSQNIASRLSALPSMGKYGQAARYWGSNVFAESMTEVFQELVPITVDEMQKHALLD
GYNARRLGDVTAELTDTFMSSLYSFALISAVGPVAGLAAGRFNGELTRREFEAAQTKLFN
MKMDNFKERIGASKVFKRFPSMSREHREAVLENADLSRAYIGAEKVETLFQQGLLPNYED
YGSAADWAQDYLGVTEDEYNESMQTGYEMELAAAKLFDAVESSDETKVNEIYDAIARDIR
FSRGGMTLAEAEAADKSISEIRREDFFNIGARTDEAREEEASARRVYEASRMQMEASGID
AETAAADSFIRSAAYRRLAGMYNSALDEKTRGNKKLLAEDMERMFPLVIEKDGTGNVTGL
TFQQTAWHGSPFRFDRFSTENIGTGEGAQAHGWGLYFAGDREVSEGYRKKLRSGRSRGQL
YKVDIPENDVLLDEQKNFAEQPETVRSALKAVYESFPAEKLALVRDELKALVRRDASLEE
EGDALRRERQKLLSRRSALNTVNAERPSENRGLFVEKGNTARFDRGVKYLHEMYYEEQIA
RLESDEAYLASEKDAVTDGLAEVTRKMEENERRIEEKRAEKKAAIDVASLDELLSRMDGR
MLYNGIVIMTDSPRAASETLNAHGVKGVTYEGELDGRSYVVFDDNDVDVMQTYYQAGALF
ERAKEAIKRVIDVAFSDKTKHRLEIISGVQQWLSDTVLQSRGLDIAGYRHCIDTSSVRHI
FKQHGDEKSERSRGQIPVTENDLLKIPEVIASPDFIVLGTKNRIGNEGIIYVKNMPNGST
FYVEEVRGKNKKQLVTDTMWIKAGTSDADSIRNTPTLYARSDTGTIDIIANPANNGGGNP
YLQPSRGSITFPQYQGAPITIHLGKDADRSTFVHEFAHLYFWHLRNLASLDTVQNTAAWE
GPEAEWNRDLKIVSRWWGENAENIARQAAQFVAEGERGGLSADGFREWLSSGMERRSAAG
AAYDRAAQEYFARGFERYLMEGKTPANSRELLSVFRRFKKWLCDIYRTLTELDVELSDEV
RSVFGRMVAADEAIEQLRAERQVDAVMAARREAAEAEARETDEANSAFAPVREPEPEYDI
AYDPYEDAKENLLGLLFSEDMPERRREMAERAEEIRPQVLQAVLAEPGYRALAMMEQAPE
LRLNPGAVVDMFSETVLSAMPEGSIADDGMTDIEFAARSLNFKSAHEMIDAMAGRRTIKE
EVDARVREIVAREFTDTFSSPAAMDAAAEAALYENDEHGERLAAEAEANFDDALELAARE
EEAEAEFRAIFEADEAARVENEDPVSRTNVVRWMRAHGRPRYSYVAREMGQEDAQALLKR
YGPSFFSKEGRGLNDIAQELDGMGIRVGGEAGLFNLLMSEAVPESPLDLAREEGRREVMD
EYRTRYKKHVAGQERRAARNAERIRRIEAKAEEKTGKAKARYKAAAERLKSQMKENHDKA
VALRKEIRARYQKRKTELEEKYKAMGERRRASFIEQKNKDWTRRALNRYLSGFRTHIEKS
VSRKGLHDAAKTAARNQVAGMTVQQLYDVTGWVRVEKDSRAAADRALRNFDEKAFREARE
KELHAHEMIRAMYRARRRAEYIRSRLVKYSNRKQKQTFGMIPEFLYQLDMLLTRFDFTKR
TKKEVAALTPKDIVREAKSLSEFIKGQTDAGVPLMIPDWIAQSESQMKYEGLFVHQLENA
FNAVQNIMQTGRDEKKTIARAKNLELSGIEAAVVERAQGYFGKDKVDGDTHIKVARKDPN
VAADVLLDLNTIEAMCRGLDGFQDDGPMQDFFFRPVREAVSREYAELNRMFGEFRSLKLR
VYGKDFKADMTPKDIGIHEYKRETDRETGKVYHVPTKEKSFFTQENIICAALNMGNADNL
ARLKDGWGWTDADIEKIKEQMSQKDWEYVQGVWDLLDTMWPKIKKVHELMTGMTIEKVEA
KPVVTKYGTFRGGYYPIVTDLRYSETAAAQNEREEVFASAPLNFASKHTKSGHRKARAEN
VLGRPPLLSFSVLDNHVANVIHDYEMASVLRDAGKILRLDKVKSVITAVYGDRGYRNFRK
WLNDIAANTKNNGVASGSGDRIVNGIKSKTAMFALGGNLGGAVSQLLGYFPLAHRIGFVN
TALAILDGLNPGSRTYDFVREKSAFMREQMDDGNSEVRKLRQNWTTNDHGISRAADMFLS
IYPFFQNMCNVPGWAQCYKIGLKRYRSEAKAVAYADSVIRQTQSASTIADLTSFERSGTI
GQLTTMFYSWFRVMYQMQNEAVMRVKYEHGINRVKDLASYAFYILIAQSVAEALLRGNGP
EPEDGEDPMWSWAKWTTARVLLSPLSTVPFAREFGSAIDNNFKFGVQLTPAQGGLDALAR
LLKIAMRQGGNALSGEDIEWGDVAEGAATVAGYRYGVPNRKMIQAAKAFWAYYDEEEAIP
WAYLILGGGYKPKDE

BLAST