GenomeNet

>tr:A0A1Y4HCA5_9FIRM [A0A1Y4HCA5] SubName: Full=Uncharacterized protein {ECO:0000313|EMBL:OUP05655.1};
MNHYDVTIRETLEVKMKVAANSREEAEQFARDQWKRGEVVLDASHFTGVEFHAKRYSRDR
GER

BLAST