GenomeNet

>tr:A0A1Y5RQB3_9RHOB [A0A1Y5RQB3] SubName: Full=Fructose dehydrogenase small subunit {ECO:0000313|EMBL:SLN22808.1};
MSPAHTRLSRRQLLVSLIAIPLFSPRSVFAQTAGTDSDIARASALLTGRSTLAPETAMRV
QELLSAQDAAFPSHLASLIRALETASGTDPQTLSDSLSDTDAATALAILEAWYLGYVGSV
STSSMDYDGKFVTYLQALMFEPTGDVTPRPAYSKRGANYWSAVPEGVAAPAMADNVATWG
LAGLKPTTSPPDPDPAWLYMMQGYATTITAARAALAGGAAPLTSDEVNAKSLAAAQASAG
AQTTGAQTSDSETREGDSK

BLAST