GenomeNet

>tr:A0A1Z5TJQ8_HORWE [A0A1Z5TJQ8] SubName: Full=Uncharacterized protein {ECO:0000313|EMBL:OTA36282.1};
MRLSSIFTAVSGLLATAGAQQWPLHDNGLNEVVQWDHYSLIVNNERVFLWTGEFHYWRLP
VPELWIDIFQKIKAAGFNGFSIYSHWGYHSAADGELDFESGAHNITRIFTIAKDLGLYVI
VRPGPYINAESTGGGFPGWLLTGDYGTTRNNDSRYTEAWAPYMAAMAQISAEHAVTNGGN
VILYQIENEYGQQWTDVDGRVPNNTAIDYMELLEASARRNGIDIPTLANNPNLGSKSWSQ
DYDINDVGGDVDIYSLDNYPSCWSCDLSVCTSVNGFPPEFTTFDYYTNFQETAPTQPLIL
AEFQGGSYNPWNGPQGGCRNNTGPNWVNVFYRNNIGNKVAGQNIYMAFGGTNWGGIPFPL
VGTSYDYSAPIAETRKLTDKYSETKLLSYFVRAAKDLTKIEKAGNGTTNFTNNPSVFAQA
LRDVDTGSHFYVTKHKNTTLTSNLTFKLNMTTSLGPMQVPQYAPEIAIDGRQAKILVTDF
AAGDDTLIYSTAEILTFSVQNGKPIIVFWVPTGESGEFYLKGAKYGSVSRCEGCANVGFH
YADEGVIVEFMQNQGMSVLEFDNGVRAVIADRSTAYNMWQPTLSNNPQAPMNETMLVKGP
YLVRSAAVEHGVICLTGDYSGAGDLEVFAPLDDEDWHSSLTHHHRKVGASRMVHFNGKAV
AMRQTKYGSLLGSLSAPNVSVESVQATIPELTEWKVQDALPERYASYNDSGAGWREAGKN
STLNPWKPETYPVLYGDEYGFHYQNLLWRGRFSGEATGVYLNVIGGAASGWSAWVNGHFL
GSTYGNISLAETNATLSFGNATREGENVLFVIQDHMGHDQTVGVLNPRGILNATLIGGEA
SNFTSWKVAGNAGGQANIDPVRGPINEGGLHAERLGWHLPGFDDSAWESGSPQDGLTEAG
AKFYRTNLPLDLPEGIDASLAFELNAPEGSKVRAQLYVNGYMFGKFIPHVGNQIEFPVFP
GILDYHGNNTIGLNIWAQDDAGASVSVKTSVLGVYQSSLDPSAGTEYLRPGWTSERLRYY

BLAST