GenomeNet

>tr:A0A222MYT1_9PROT [A0A222MYT1] SubName: Full=PAS domain-containing transcriptional regulator, YheO family {ECO:0000313|EMBL:ASQ30712.1};
MRAEKKEHFIKLCKFLGQVLGKRYEVVFHVIEESGAYIAAIENNQVSGRTTNSPLTAFAS
ELVQNKSYLDKDFLCGYKAMVNKDKMVRGSTFFIKDKDKLEGILCINYDTSEMRDVVAKI
IDIEKLDDMSSILNLKQEDDNNVEVLNHSIEEILTQYVDVKYLESDFLLTTEQKQSIISK
LYKKGVFNVKGAISVVAKFLKLSEPSVYRYLGNVKKDMK

BLAST