GenomeNet

>tr:A0A235IDP1_9NOSO [A0A235IDP1] RecName: Full=TPR_REGION domain-containing protein {ECO:0000259|PROSITE:PS50293};
MKKNAKFECNFCCSFSQVSRYSLTVLLSVLFLSDAVGATSISRWLQITQQMQADLQKSID
AAVEQGYTDSFSEKIGKKVSANVKIAQSPDAKPQNTNPAPSEAEAKIKPLWDKAHQLLEE
GNQLRNQPSAAAVRQAITKYEEALKIWRLPEVRAAKPQEAPFIEAVTLSLIGTIYNTPTE
NTKAVGYLEQALAIVQESQESKAREWKALILTSLGGVYRDLGEKQKAIDAYNQAQSLYHA
DKQPKKEANVLFSIAVVYKVFDEPKKEHEFLERALAIQKANNDLPGQAKTLGTIAGNYQL
LGETNKALDYYQQVLKIYSQTKYLFGQAETFIDIGSVYSFKGDRSSAEKYFQQGLELRKT
IARQIQQDPKNPLGRRDFFESQISILYSIATGYFYLGDIQQQIVYLNQARTIAHQIGSFQ
REANFIFLIGDAYSLLGETQKALENLNQALKLQRDIHDYQGEAETLVSIAYLHTKSKEFQ
QALDILFNQALEVSKRQQNHRIEAKTLYQIANVYEKLGAYDLSIDKYKEVLKISQQSNPN
LIVNGFYSIGGVYLQLCFSQKKAEDCHQALKYFEDASKSAGETYLIKNYVLSSTSLAYEF
LKEYPKAIAKAKQALELSRKKNIKEAERLALRALSTAYEGAGDYQNALDTNKQHLLLSQQ
LGDVSSQANAYQIRGKIYTSMKQPQQAIEAYNQELKLGQQIGDTSEQTHPLYKIAIIERD
RGNLNQAKTHIEAGINIIENTRNKVNSDDLRTFYFATVQDYYKFYIDLLMRLHKKDPLKG
YNALALHISERSRARVLVELLKEGNVNLGKDVDPQLLAEERRLNFKLNAKDKFLSDLFSR
KEPPTELIAKTKQEITNIIQESQSISEKIRATNPERAELIDPKDVLELSGIQQQLDQDTV
MLQYSLGEERSYLWVVTPNSLQSYELPGQEKIAKAAKKFNSLLKQKLIDRGTPEDNAQTF
ANTDKAADALSQIILAPVAGKLGNKRLVIVADGILHQVPFAALNEPRKSPASAEYQPLVV
NHEIVNLPSISSLATHRKKLKGRKIAPKTLAVLANPVFGVDDARLKNDKPSTVENNLDRS
ALETSLRNINQDKLDPLPGTKDEGEAILSLVNSPGEKLSAFDFDANYNFATSKQLSQYRL
LLFATHGIFDPVNPALSGIVLSLVDKQGKPQTRGFLRLNDIFNLDLPVELIVLSACESGL
GDDVQGEGLVGLTRGFMYAGAARVTVSLWNVNDQSTKELMIGFYKQILAQKKSPAAALNL
AQRQMWQGKDFQGNDLKNPEWKHPRYWAAFTLQGEWR

BLAST