GenomeNet

>tr:A0A243PEU0_9SPHN [A0A243PEU0] RecName: Full=LPD22 domain-containing protein {ECO:0000259|Pfam:PF18834};
MSDLLDQFLGGKSPSKVDPLDEELRDIAAARRSIIMHNAASPDAAARANVLSRENGLPPT
IVEQHLPAFEIARRSERANALMAKHPAIGRWSSDPRNIAAAADDYDNLGKLGAAFASRIA
RDKRDLMASGGFVERMGDLFKSGVYSLDQGAAAVRGALQDWSARNPLPWTSAENTEAAVV
AARQARAIARISRDMAGTKVAGETDWSAVKERPTPGNVLKFGLDQTVKSVPGMAQAALML
PAYILGQAGSIGQTRANVQGREDADLQDVGEATPAALLSAALERIGIRGIFGATGKNAVM
RATKAGATEAVTEFGQSAVEYIGGHSQTGTEFSTDEMLDQAFAGAVAGGVMGGGMRGTVE
ASGPVARRARGLVKQFTAANDAVLDGQFLDGLGKAINGTKLATRDPDALSSLIRDLGEEV
GVEQVFISGEKIVAYQSSGADNDYFGECACPWRT

BLAST