GenomeNet

>tr:A0A255ZX04_9FLAO [A0A255ZX04] SubName: Full=Uncharacterized protein {ECO:0000313|EMBL:OYQ46023.1};
METFKIEVQEFLSRIIEVQANSSDEAISKVQEMYRNEEIVLDSEDFVSTEIDIFPKKEII
SFDLLSNGSNFYMVEGDNITFWGKDIISKVAKITPEVLIVISDNEIPLNEPCEFVDEVDY
KIFLLLYYLS

BLAST