GenomeNet

>tr:A0A261AGR7_9PELO [A0A261AGR7] SubName: Full=Uncharacterized protein {ECO:0000313|EMBL:OZF96719.1}; Flags: Fragment;
MADIETQRRHGILFQFLSLLVTEENIDYARLGYRLLHDLDFRLEHYIHIYDIAMDARNDI
AEAGLLVEKIDRMQNQSSFTPRKKAKDDKRSEGIREAVGE

BLAST